General Information

  • ID:  hor002797
  • Uniprot ID:  P07712
  • Protein name:  Proline-rich mature peptide
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Neurons L2-4 and L6, also called giant dorsal LUQ (Left Upper Quadrant) neurons of the abdominal ganglion. Also expressed in smaller neurons in the CNS and in peripheral organs such as the kidney.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TIPDRLPQTEESSLPDFGFSHLPALPLELFYNPRDLVHSGFRPRLCSVSGVEGYPPCVESHSDRKMKNLLDDLFGL
  • Length:  76(37-112)
  • Propeptide:  MKTAVLLVCLAYVMAAILSLCASAPSWRPQGRFGKRTIPDRLPQTEESSLPDFGFSHLPALPLELFYNPRDLVHSGFRPRLCSVSGVEGYPPCVESHSDRKMKNLLDDLFGL
  • Signal peptide:  MKTAVLLVCLAYVMAAILSLCAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07712-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002797_AF2.pdbhor002797_ESM.pdb

Physical Information

Mass: 989362 Formula: C384H590N102O114S3
Absent amino acids: W Common amino acids: L
pI: 4.98 Basic residues: 10
Polar residues: 21 Hydrophobic residues: 23
Hydrophobicity: -34.34 Boman Index: -13105
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 83.29
Instability Index: 4396.71 Extinction Coefficient cystines: 3105
Absorbance 280nm: 41.4

Literature

  • PubMed ID:  7784264
  • Title:  Processing of the L5-67 Precursor Peptide and Characterization of LUQIN in the LUQ Neurons of Aplysia Californica